Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN184230

GABRD (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIG10, EJM7, GEFSP5, AI853201, GABAA-RD, GABRD
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN184230
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GABRD antibody: synthetic peptide directed towards the N terminal of human GABRD
Sequence MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISW LPNLDGLIAG
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Chicken : 76%
Characteristics This is a rabbit polyclonal antibody against GABRD. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Background Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. The GABRD gene encodes the delta subunit.Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
Molecular Weight 51kDa
Gene ID 2563
NCBI Accession NP_000806, NM_000815
UniProt O14764
Research Area Receptors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GABRD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Emberger, Windpassinger, Petek et al.: "Assignment of the human GABAA receptor delta-subunit gene (GABRD) to chromosome band 1p36.3 distal to marker NIB1364 by radiation hybrid mapping." in: Cytogenetics and cell genetics, Vol. 89, Issue 3-4, pp. 281-2, 2000 (PubMed).

Windpassinger, Kroisel, Wagner et al.: "The human gamma-aminobutyric acid A receptor delta (GABRD) gene: molecular characterisation and tissue-specific expression." in: Gene, Vol. 292, Issue 01. Feb, pp. 25-31, 2002 (PubMed).

Alternatives for antigen "GABRD", type "Antibodies"
Hosts (51), (6), (1)
Reactivities (47), (41), (38), (17), (17), (1)
Applications (41), (18), (13), (12), (11), (10), (7), (6), (5), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (6), (2), (2), (1), (1), (1), (1)
Beacon