Did you know that you can buy products from over 140 different suppliers from us?

GABRD (N-Term) antibody

Details for Product No. ABIN184230
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GABRD, EIG10, EJM7, GEFSP5, GABAA-RD, AI853201
Epitope
N-Term
(21), (15), (8), (7), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(64), (45), (41), (17), (17), (1)
Host
Rabbit
(57), (24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(64), (23), (22), (20), (17), (14), (13), (10), (9), (5), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN184230
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GABRD
Sequence MDAPARLLAPLLLLCAQQLRGTRAMNDIGDYVGSNLEISW LPNLDGLIAG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against GABRD. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Background Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. The GABRD gene encodes the delta subunit.Gamma-aminobutyric acid (GABA) is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA-A receptors, which are ligand-gated chloride channels. Chloride conductance of these channels can be modulated by agents such as benzodiazepines that bind to the GABA-A receptor. The GABA-A receptor is generally pentameric and there are five types of subunits: alpha, beta, gamma, delta, and rho. This gene encodes the delta subunit.
Molecular Weight 51 kDa
Gene ID 2563
NCBI Accession NM_000815, NP_000806
UniProt O14764
Research Area Receptors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 452 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GABRD (N-Term) antibody WB Suggested Anti-GABRD Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-GABRD (N-Term) antibody (2) anti-GABRD (N-Term) antibody (Image 2)
Background publications Emberger, Windpassinger, Petek et al.: "Assignment of the human GABAA receptor delta-subunit gene (GABRD) to chromosome band 1p36.3 distal to marker NIB1364 by radiation hybrid mapping." in: Cytogenetics and cell genetics, Vol. 89, Issue 3-4, pp. 281-2, 2000 (PubMed).

General Windpassinger, Kroisel, Wagner et al.: "The human gamma-aminobutyric acid A receptor delta (GABRD) gene: molecular characterisation and tissue-specific expression." in: Gene, Vol. 292, Issue 01. Feb, pp. 25-31, 2002 (PubMed).

Validation Images
back to top