IL21 Receptor antibody (AA 35-64)
-
- Target See all IL21 Receptor (IL21R) Antibodies
- IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))
-
Binding Specificity
- AA 35-64
-
Reactivity
- Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IL21 Receptor antibody is un-conjugated
-
Application
- ELISA, Immunohistochemistry (IHC), Flow Cytometry (FACS)
- Specificity
- Peptide sequence is <50 % identical to other sequences in GenBank. The antibody recognizes mouse IL-21 receptor. Not tested for cross-reactivity to human IL-21 receptor.
- Predicted Reactivity
- Percent identity by BLAST analysis: Mouse (100%) Rat (90%).
- Purification
- Immunoaffinity purified
- Immunogen
-
Synthetic peptide CVLETRSPNPSILSLTWQDEYEELQDQETF corresponding to 35-65 residues of N-terminus of mouse IL-21 receptor. Percent identity by BLAST analysis: Mouse (100%), Rat (90%).
Type of Immunogen: Synthetic peptide - Top Product
- Discover our top product IL21R Primary Antibody
-
-
- Application Notes
- Approved: ELISA (1:100000), Flo, IHC
- Comment
-
Target Species of Antibody: Mouse
- Restrictions
- For Research Use only
-
- Format
- Liquid
- Concentration
- Lot specific
- Buffer
- 10 mM KHPO4, 140 mM NaCl with 1 mg/mL BSA and 0.1 % sodium azide
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Aliquot to Avoid freeze/thaw cycles.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C. Aliquot to avoid freeze/thaw cycles.
-
- Target
- IL21 Receptor (IL21R) (Interleukin 21 Receptor (IL21R))
- Alternative Name
- IL21R / IL-21R (IL21R Products)
- Synonyms
- IL21R antibody, il-21ra.a antibody, CD360 antibody, NILR antibody, interleukin 21 receptor antibody, interleukin 21 receptor, tandem duplicate 1 antibody, IL21R antibody, il21r.1 antibody, Il21r antibody
- Background
-
Name/Gene ID: IL21R
Family: Interleukin
Synonyms: IL21R, CD360, Interleukin 21 receptor, Interleukin-21 receptor, NILR, IL-21 receptor, CD360 antigen, IL-21R, IL21 Receptor, Novel interleukin receptor - Gene ID
- 50615
- UniProt
- Q9HBE5
- Pathways
- JAK-STAT Signaling
-