GNAQ antibody (N-Term)
-
- Target See all GNAQ Antibodies
- GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))
-
Binding Specificity
- AA 102-138, N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GNAQ antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human,Rat,Mouse.
- Sequence
- KYEHNKAHAQ LVREVDVEKV SAFENPYVDA IKSLWND
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Guanine nucleotide-binding protein G(q) subunit alpha(GNAQ) detection. Tested with WB, IHC-P in Human,Rat,Mouse.
Gene Name: guanine nucleotide binding protein (G protein), q polypeptide
Protein Name: Guanine nucleotide-binding protein G(q) subunit alpha - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product GNAQ Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))
- Alternative Name
- GNAQ (GNAQ Products)
- Synonyms
- si:ch73-270f14.2 antibody, CMC1 antibody, G-ALPHA-q antibody, GAQ antibody, SWS antibody, Galphaq antibody, Gnaq antibody, g-alpha-q antibody, gaq antibody, gnaqb antibody, 1110005L02Rik antibody, 6230401I02Rik antibody, AA408290 antibody, AW060788 antibody, Dsk1 antibody, Dsk10 antibody, Gq antibody, GqI antibody, guanine nucleotide binding protein (G protein), q polypeptide antibody, G protein subunit alpha q antibody, guanine nucleotide binding protein (G protein), q polypeptide S homeolog antibody, guanine nucleotide binding protein, alpha q polypeptide antibody, gnaq antibody, GNAQ antibody, Gnaq antibody, gnaq.S antibody
- Background
-
Guanine nucleotide-binding protein G(q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.
Synonyms: CMC1 antibody|G alpha Q antibody|G protein alpha Q antibody|G-ALPHA-q antibody|GAQ antibody|GNAQ antibody|GNAQ_HUMAN antibody|guanine nucleotide binding protein (G protein), q polypeptide antibody|Guanine nucleotide binding protein alpha q antibody|guanine nucleotide binding protein G protein q polypeptide antibody|Guanine nucleotide binding protein G q subunit alpha antibody|Guanine nucleotide-binding protein alpha-q antibody|Guanine nucleotide-binding protein G(q) subunit alpha antibody|SWS antibody - Gene ID
- 2776
- UniProt
- P50148
- Pathways
- JAK-STAT Signaling, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction
-