Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) antibody

Antigen: Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4)

Synonyms: FLJ40832, AV005916, 3j828, MGC52849, MGC132353, MGC79644

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine)

Conjugate: Un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Catalog no.: ABIN309673

Additional Information

Alternative name: PDK4

Gene ID: PDK4

UniProt: Q16654

Immunogen: The immunogen for anti-PDK4 antibody: synthetic peptide directed towards the N terminal of human PDK4

Sequence: MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQL LDFGSENACE

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-PDK4 antibody concentration is 1 mg/ml.

Description: PDK4 is a member of the PDK/BCKDK protein kinase family and is a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism.This gene is a member of the PDK/BCKDK protein kinase family and encodes a mitochondrial protein with a histidine kinase domain. This protein is located in the matrix of the mitrochondria and inhibits the pyruvate dehydrogenase complex by phosphorylating one of its subunits, thereby contributing to the regulation of glucose metabolism. Expression of this gene is regulated by glucocorticoids, retinoic acid and insulin.

Characteristics: Antigen Size: 411 amino acids

Molecular Weight: 46kDa

Application Details

Application Notes: WB Suggested Anti-PDK4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism

Restrictions: For Research Use only

Images

WB Suggested Anti-PDK4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Transfected 293T

Sample Type: Huh7 HepG2 (50ug)
Primary Antibody Dilution: 1:500
Image Submitted By: Partha Kasturi
University of Kansas Medical Center

anti-Pyruvate Dehydrogenase Kinase, Isozyme 4 (PDK4) antibody (Image 3)

Publications

Product: Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).