Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN309830

Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mis5, P105MCM, MCG40308, Mcmd6, ASP-l1, D1Wsu22e, CG4039, DmMCM6, DmeMCM6, Dmel\\CG4039, MCM6, McM6, fs(1)K1214, mcm6
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN309830
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MCM6 antibody: synthetic peptide directed towards the C terminal of human MCM6
Sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPY LVVNPNYLLE
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against MCM6. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name MCM6
Background The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.
Molecular Weight 90kDa
Gene ID 4175
NCBI Accession NP_005906, NM_005915
UniProt Q14566
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MCM6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "Minichromosome Maintenance Complex Component 6 (MCM6)", type "Antibodies"
Hosts (28), (3), (2)
Reactivities (30), (12), (7), (1), (1)
Applications (31), (14), (11), (4), (2), (2), (2), (1), (1), (1)
Epitopes (5), (4), (2), (2), (2), (1)
Beacon