Did you know that you can buy products from over 140 different suppliers from us?

Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody

Details for Product No. ABIN309830
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Mis5, P105MCM, MCG40308, Mcmd6, ASP-l1, D1Wsu22e, CG4039, DmMCM6, DmeMCM6, Dmel\\CG4039, MCM6, McM6, fs(1)K1214, mcm6
Epitope
C-Term
(9), (8), (7), (4), (1)
Reactivity
Dog (Canine), Human
(37), (12), (8), (1), (1)
Host
Rabbit
(32), (4), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(37), (17), (14), (11), (6), (3), (3), (1), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN309830
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MCM6
Sequence RIIEKVIHRLTHYDHVLIELTQAGLKGSTEGSESYEEDPY LVVNPNYLLE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Rabbit : 100 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against MCM6. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name MCM6
Background The protein encoded by the MCM6 gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 7 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. The phosphorylation of the complex by CDC2 kinase reduces the helicase activity, suggesting a role in the regulation of DNA replication.
Molecular Weight 90 kDa
Gene ID 4175
NCBI Accession NM_005915, NP_005906
UniProt Q14566
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 821 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody WB Suggested Anti-MCM6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody (2) Immunohistochemistry with Thymus tissue at an antibody concentration of 5µg/ml using anti-MCM6 antibody (ARP36650_P050)
anti-Minichromosome Maintenance Complex Component 6 (MCM6) (C-Term) antibody (3) Thymus
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN309830
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top