Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibody

Details for Product No. ABIN310007
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Hsh155, MDS, PRP10, PRPF10, SAP155, SF3b155, TA-8, Prp10, Targ4, 155kDa, AA409119, 2810001M05Rik, hsh155, prp10, prpf10, sap155, Sap155, wu:fb99f09, SF3B1
Epitope
N-Term
(5), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(26), (22), (15), (3), (3), (3), (2), (2), (1)
Host
Rabbit
(27), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (10), (7), (5), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN310007
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SF3B1
Sequence MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYD QEIYGGSDSR
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Goat : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against SF3B1. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name SF3B1
Background SF3B1 is subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures.This gene encodes subunit 1 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. The carboxy-terminal two-thirds of subunit 1 have 22 non-identical, tandem HEAT repeats that form rod-like, helical structures. Alternative splicing results in multiple transcript variants encoding different isoforms.
Molecular Weight 143 kDa
Gene ID 23451
NCBI Accession NM_012433, NP_036565
UniProt O75533
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1304 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibody anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibody
anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibody (2) anti-Splicing Factor 3b, Subunit 1, 155kDa (SF3B1) (N-Term) antibody (Image 2)
Background publications Beausoleil, Jedrychowski, Schwartz et al.: "Large-scale characterization of HeLa cell nuclear phosphoproteins." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 101, Issue 33, pp. 12130-5, 2004 (PubMed).

Hosts (27), (4)
Reactivities (26), (22), (15), (3), (3), (3), (2), (2), (1)
Applications (22), (10), (7), (5), (4), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (3), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top