Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310067

Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2810431B21Rik, 6720478K01Rik, Fars1, COXPD14, FARS1, HSPC320, PheRS, dJ520B18.2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 2 references available
Catalog no. ABIN310067
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FARS2 antibody: synthetic peptide directed towards the N terminal of human FARS2
Sequence VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIK ERVKEHFYKQ
Predicted Reactivity Rabbit : 100%, Bovine : 92%, Mouse : 92%, Rat : 92%, Horse : 83%
Characteristics This is a rabbit polyclonal antibody against FARS2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name FARS2
Background Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS1 encodes a mitochondrially-located phenylalanine-tRNA synthetase (PheRS) which consists of a single polypeptide chain unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and the eukaryotic cytoplasm.
Molecular Weight 50kDa
Gene ID 10667
NCBI Accession NP_006558, NM_006567
UniProt O95363
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FARS2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Brandenberger, Wei, Zhang et al.: "Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation." in: Nature biotechnology, Vol. 22, Issue 6, pp. 707-16, 2004 (PubMed).

Zhang, Walker, Tamplin et al.: "Zfp206 regulates ES cell gene expression and differentiation." in: Nucleic acids research, Vol. 34, Issue 17, pp. 4780-90, 2006 (PubMed).

Alternatives for antigen "Phenylalanine-tRNA Synthetase 2 (Mitochondrial) (FARS2)", type "Antibodies"
Hosts (8), (3)
Reactivities (10), (2), (2)
Applications (9), (5), (4), (2), (1)
Epitopes (2), (2), (1), (1), (1)
Beacon