Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310422

THO Complex 4 (THOC4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALY, ALY/REF, BEF, REF, THOC4, REF1, Refbp1, Thoc4, tho4, thoc4, zgc:171753, Tho4-A, alyref-a, thoc4-a, Aly
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310422
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-THOC4 antibody: synthetic peptide directed towards the N terminal of human THOC4
Sequence GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHD LFDSGFGGGA
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against THOC4. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name THOC4
Background THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.
Molecular Weight 28kDa
Gene ID 10189
NCBI Accession NP_005773, NM_005782
UniProt Q86V81
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-THOC4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Strässer, Masuda, Mason et al.: "TREX is a conserved complex coupling transcription with messenger RNA export." in: Nature, Vol. 417, Issue 6886, pp. 304-8, 2002 (PubMed).

Alternatives for antigen "THO Complex 4 (THOC4)", type "Antibodies"
Hosts (20), (11)
Reactivities (29), (12), (10), (6)
Applications (31), (19), (10), (9), (7), (5), (2), (2), (2)
Epitopes (8), (2), (2), (1), (1), (1), (1), (1)
Beacon