THO Complex 4 (THOC4) (N-Term) antibody

Details for Product No. ABIN310422
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALY, ALY/REF, BEF, REF, THOC4, REF1, Refbp1, Thoc4, tho4, thoc4, zgc:171753, Tho4-A, alyref-a, thoc4-a, Aly
Epitope
N-Term
(8), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Cow (Bovine), Xenopus laevis, Human, Chicken
(31), (12), (10), (5), (1)
Host
Rabbit
(21), (12)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(33), (21), (11), (10), (6), (5), (4), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN310422
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human THOC4
Sequence GGGPIRNRPAIARGAAGGGGRNRPAPYSRPKQLPDKWQHD LFDSGFGGGA
Predicted Reactivity Bovine : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against THOC4. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name THOC4
Background THOC4 is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.The protein encoded by this gene is a heat stable, nuclear protein and functions as a molecular chaperone. It is thought to regulate dimerization, DNA binding, and transcriptional activity of basic region-leucine zipper (bZIP) proteins.
Molecular Weight 28 kDa
Gene ID 10189
NCBI Accession NM_005782, NP_005773
UniProt Q86V81
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 257 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-THO Complex 4 (THOC4) (N-Term) antibody WB Suggested Anti-THOC4 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Strässer, Masuda, Mason et al.: "TREX is a conserved complex coupling transcription with messenger RNA export." in: Nature, Vol. 417, Issue 6886, pp. 304-8, 2002 (PubMed).

Hosts (21), (12)
Reactivities (31), (12), (10), (5), (1)
Applications (33), (21), (11), (10), (6), (5), (4), (2), (2), (1)
Epitopes (8), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top