Did you know that you can buy products from over 140 different suppliers from us?

Retinoic Acid Receptor, beta (RARB) (C-Term) antibody

Details for Product No. ABIN310689
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RARB, nRARs, HAP, NR1B2, RRB2, A830025K23, Hap, Nr1b2, RARbeta2, RARBETA
Epitope
C-Term
(22), (10), (7), (7), (6), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Human, Chicken
(80), (31), (16), (14), (12), (12), (12), (1), (1)
Host
Rabbit
(71), (13)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(57), (30), (21), (16), (10), (6), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN310689
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RARB
Sequence SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS SGNTAEHSPS
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against RARB. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RARB
Background RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants, one additional transcript has been described, but its full length nature has not been determined.
Molecular Weight 50 kDa
Gene ID 5915
NCBI Accession NM_000965, NP_000956
UniProt P10826
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 448 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retinoic Acid Receptor, beta (RARB) (C-Term) antibody WB Suggested Anti-RARB Antibody Titration: 0.2-1 ug/ml
Positive Control: Human brain
anti-Retinoic Acid Receptor, beta (RARB) (C-Term) antibody (2) IHC Information: Paraffin embedded brain, cortex tissue, tested with an antibody dilution of 5 ug/ml.
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Validation Images
back to top