Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310689

Retinoic Acid Receptor, beta (RARB) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HAP, RRB2, NR1B2, RARBETA, A830025K23, Hap, Nr1b2, RARbeta2, RARB, nRARs
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310689
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RARB antibody: synthetic peptide directed towards the C terminal of human RARB
Sequence SAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS SGNTAEHSPS
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Chicken : 92%
Characteristics This is a rabbit polyclonal antibody against RARB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RARB
Background RARB is a retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. This gene encodes retinoic acid receptor beta, a member of the thyroid-steroid hormone receptor superfamily of nuclear transcriptional regulators. This receptor localizes to the cytoplasm and to subnuclear compartments. It binds retinoic acid, the biologically active form of vitamin A which mediates cellular signalling in embryonic morphogenesis, cell growth and differentiation. It is thought that this protein limits growth of many cell types by regulating gene expression. The gene was first identified in a hepatocellular carcinoma where it flanks a hepatitis B virus integration site. The gene expresses at least two transcript variants, one additional transcript has been described, but its full length nature has not been determined.
Molecular Weight 50kDa
Gene ID 5915
NCBI Accession NP_000956, NM_000965
UniProt P10826
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RARB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).

Alternatives for antigen "Retinoic Acid Receptor, beta (RARB)", type "Antibodies"
Hosts (56), (17)
Reactivities (67), (29), (17), (15), (13), (12), (12), (1), (1)
Applications (44), (26), (19), (10), (9), (7), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (11), (8), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon