Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN310976

CD36 Molecule (thrombospondin Receptor) (CD36) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BDPLT10, CHDS7, FAT, GP3B, GP4, GPIV, PASIV, SCARB3, Fat, Scarb3, GPIIIB, PAS-4
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN310976
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CD36 antibody: synthetic peptide directed towards the N terminal of human CD36
Sequence MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKK QVVLEEGTIA
Predicted Reactivity Human : 100%, Bovine : 78%, Dog : 78%, Goat : 78%, Pig : 78%, Rabbit : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against CD36. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name CD36
Background CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Three alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.
Molecular Weight 53kDa
Gene ID 948
NCBI Accession NP_001001547, NM_001001547
UniProt P16671
Research Area Cancer, Atherosclerosis, Hematopoietic Progenitors, Hematopoietic Stem Cells, CD Antigens, Surface Receptors of Immune Cells
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CD36 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ozer, Negis, Aytan et al.: "Vitamin E inhibits CD36 scavenger receptor expression in hypercholesterolemic rabbits." in: Atherosclerosis, Vol. 184, Issue 1, pp. 15-20, 2005 (PubMed).

Alternatives for antigen "CD36 Molecule (thrombospondin Receptor) (CD36)", type "Antibodies"
Hosts (159), (89), (22), (3), (1)
Reactivities (210), (97), (70), (25), (17), (15), (13), (13), (3), (2), (1)
Applications (168), (116), (48), (43), (40), (32), (28), (26), (22), (20), (17), (12), (7), (1), (1), (1), (1)
Conjugates (36), (15), (13), (8), (8), (6), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Epitopes (9), (6), (5), (5), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon