Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311480

DPH1 Homolog (S. Cerevisiae) (DPH1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ovca1, Dph2l1, AW551873, 2310011M22Rik, 4930488F09Rik, RGD1562694, DPH1-OVCA2, DPH2L, DPH2L1, OVCA1, zgc:110702, dph1-ovca2, dph2l, dph2l1, ovca1, DPH1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311480
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DPH1 antibody: synthetic peptide directed towards the middle region of human DPH1
Sequence RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLES RLRALGLSFV
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, African clawed frog : 92%, Rat : 92%, Zebrafish : 92%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against DPH1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DPH1
Background Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).
Molecular Weight 49kDa
Gene ID 1801
NCBI Accession NP_001374, NM_001383
UniProt Q9BZG8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DPH1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).

Alternatives for antigen "DPH1 Homolog (S. Cerevisiae) (DPH1)", type "Antibodies"
Hosts (26), (4)
Reactivities (28), (14), (14), (12), (12)
Applications (21), (10), (10), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (2), (1), (1), (1)
Beacon