Did you know that you can buy products from over 140 different suppliers from us?

DPH1 Homolog (S. Cerevisiae) (DPH1) (Middle Region) antibody

Details for Product No. ABIN311480
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DPH1, DPH1-OVCA2, dph1-ovca2, dph2l, dph2l1, ovca1, DPH2L, DPH2L1, OVCA1, zgc:110702, 2310011M22Rik, 4930488F09Rik, AW551873, Dph2l1, Ovca1, RGD1562694
Epitope
Middle Region
(8), (7), (6), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(38), (14), (14), (12), (12)
Host
Rabbit
(30), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(31), (17), (10), (7), (3), (3)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311480
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DPH1
Sequence RMQAARQEAIATARSAKSWGLILGTLGRQGSPKILEHLES RLRALGLSFV
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, African clawed frog : 90 %, Rat : 90 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against DPH1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DPH1
Background Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]). Diphthamide is a unique posttranslationally modified histidine found only in translation elongation factor-2 (EEF2, MIM 130610). This modification is conserved from archaebacteria to humans and serves as the target for ADP-ribosylation and inactivation of EEF2 by diphtheria toxin (DT) and Pseudomonas exotoxin A. DPH1 is 1 of several enzymes involved in synthesis of diphthamide in EEF2 (Liu et al., 2004 [PubMed 15485916]).
Molecular Weight 49 kDa
Gene ID 1801
NCBI Accession NM_001383, NP_001374
UniProt Q9BZG8
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 443 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DPH1 Homolog (S. Cerevisiae) (DPH1) (Middle Region) antibody WB Suggested Anti-DPH1 Antibody Titration: 0.2-1 ug/ml
Positive Control: MCF7 cell lysate
Background publications Liu, Milne, Kuremsky et al.: "Identification of the proteins required for biosynthesis of diphthamide, the target of bacterial ADP-ribosylating toxins on translation elongation factor 2." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9487-97, 2004 (PubMed).

Validation Images
back to top