Did you know that you can buy products from over 140 different suppliers from us?

Solute Carrier Family 25 (Mitochondrial Oxodicarboxylate Carrier), Member 21 (Slc25a21) (N-Term) antibody

Details for Product No. ABIN405618
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms zgc:153387, 9930033G19Rik, A630030I10, BB158148, Odc1, ODC, ODC1
Epitope
N-Term
(5), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
(14), (9), (9)
Host
Rabbit
(16), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (10), (7), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405618
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SLC25A21
Sequence FYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALT FAIAGLGSGL
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against SLC25A21. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SLC25A21
Background SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.SLC25A21 is a homolog of the S. cerevisiae ODC proteins, mitochondrial carriers that transport C5-C7 oxodicarboxylates across inner mitochondrial membranes. One of the species transported by ODC is 2-oxoadipate, a common intermediate in the catabolism of lysine, tryptophan, and hydroxylysine in mammals. Within mitochondria, 2-oxoadipate is converted into acetyl-CoA.
Molecular Weight 33 kDa
Gene ID 89874
NCBI Accession NM_030631, NP_085134
UniProt Q9BQT8
Research Area Signaling, Metabolism, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 299 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Fiermonte, Dolce, Palmieri et al.: "Identification of the human mitochondrial oxodicarboxylate carrier. Bacterial expression, reconstitution, functional characterization, tissue distribution, and chromosomal location." in: The Journal of biological chemistry, Vol. 276, Issue 11, pp. 8225-30, 2001 (PubMed).

Hosts (16), (1)
Reactivities (14), (9), (9)
Applications (15), (10), (7), (3), (1)
Epitopes (5), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405618
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top