Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405954

Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 0710008N11Rik, Ip, succinate dehydrogenase 2-3, CG3283, Dmel\\CG3283, SDH, SDH-IP, SDH-Ip, SDHb, sdhB, CWS2, IP, PGL4, SDH1, SDH2, SDHIP, fj46d06, wu:fj46d06
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405954
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SDHB antibody: synthetic peptide directed towards the middle region of human SDHB
Sequence YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPK GLNPGKAIAE
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against SDHB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SDHB
Background Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
Molecular Weight 31kDa
Gene ID 6390
NCBI Accession NP_002991, NM_003000
UniProt P21912
Research Area Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SDHB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Cascón, Landa, López-Jiménez et al.: "Molecular characterisation of a common SDHB deletion in paraganglioma patients." in: Journal of medical genetics, Vol. 45, Issue 4, pp. 233-8, 2008 (PubMed).

Alternatives for antigen "Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB)", type "Antibodies"
Hosts (34), (8)
Reactivities (40), (23), (16), (12), (12), (12), (1), (1), (1)
Applications (32), (14), (10), (8), (8), (5), (5), (1), (1), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (6), (2), (2), (1), (1), (1), (1)
Beacon