Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB) (Middle Region) antibody

Details for Product No. ABIN405954
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 0710008N11Rik, Ip, succinate dehydrogenase 2-3, CG3283, Dmel\\CG3283, SDH, SDH-IP, SDH-Ip, SDHb, sdhB, CWS2, IP, PGL4, SDH1, SDH2, SDHIP, fj46d06, wu:fj46d06
Epitope
Middle Region
(8), (7), (6), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
(41), (26), (17), (12), (12), (12), (1), (1), (1), (1)
Host
Rabbit
(38), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(35), (14), (10), (10), (10), (6), (5), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405954
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SDHB
Sequence YRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPK GLNPGKAIAE
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against SDHB. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SDHB
Background Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
Molecular Weight 31 kDa
Gene ID 6390
NCBI Accession NM_003000, NP_002991
UniProt P21912
Research Area Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 280 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Succinate Dehydrogenase Complex, Subunit B, Iron Sulfur (Ip) (SDHB) (Middle Region) antibody WB Suggested Anti-SDHB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate
Background publications Cascón, Landa, López-Jiménez et al.: "Molecular characterisation of a common SDHB deletion in paraganglioma patients." in: Journal of medical genetics, Vol. 45, Issue 4, pp. 233-8, 2008 (PubMed).

Hosts (38), (7)
Reactivities (41), (26), (17), (12), (12), (12), (1), (1), (1), (1)
Applications (35), (14), (10), (10), (10), (6), (5), (2), (1), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (7), (6), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top