Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405998

Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1810003P21Rik, AI314789, AT, AGAT, CCDS3, cb409, wu:fa08a06, zgc:65855
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Pig (Porcine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405998
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GATM antibody: synthetic peptide directed towards the middle region of human GATM
Sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYR VHIISFKDPN
Predicted Reactivity African clawed frog : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Bovine : 92%, Chicken : 92%, Rabbit : 92%, Zebrafish : 91%
Characteristics This is a rabbit polyclonal antibody against GATM. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GATM
Background GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.
Molecular Weight 44kDa
Gene ID 2628
NCBI Accession NP_001473, NM_001482
UniProt P50440
Research Area Signaling, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GATM antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lion-François, Cheillan, Pitelet et al.: "High frequency of creatine deficiency syndromes in patients with unexplained mental retardation." in: Neurology, Vol. 67, Issue 9, pp. 1713-4, 2006 (PubMed).

Alternatives for antigen "Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM)", type "Antibodies"
Hosts (26), (4)
Reactivities (25), (14), (14), (12), (12), (2), (1), (1)
Applications (21), (10), (9), (9), (7), (4), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (2), (2), (1), (1), (1)
Beacon