Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM) (Middle Region) antibody

Details for Product No. ABIN405998
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 1810003P21Rik, AI314789, AT, AGAT, CCDS3, cb409, wu:fa08a06, zgc:65855
Epitope
Middle Region
(3), (2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Dog (Canine), Pig (Porcine), Cow (Bovine), Human, Chicken
(27), (15), (15), (12), (12), (2), (1), (1)
Host
Rabbit
(28), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(23), (10), (9), (8), (7), (4), (3), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN405998
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human GATM
Sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYR VHIISFKDPN
Predicted Reactivity African clawed frog : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 90 %, Rabbit : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against GATM. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GATM
Background GATM is a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by mental retardation, language impairment, and behavioral disorders.
Molecular Weight 44 kDa
Gene ID 2628
NCBI Accession NM_001482, NP_001473
UniProt P50440
Research Area Signaling, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 423 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glycine Amidinotransferase (L-Arginine:glycine Amidinotransferase) (GATM) (Middle Region) antibody WB Suggested Anti-GATM Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Background publications Lion-François, Cheillan, Pitelet et al.: "High frequency of creatine deficiency syndromes in patients with unexplained mental retardation." in: Neurology, Vol. 67, Issue 9, pp. 1713-4, 2006 (PubMed).

Hosts (28), (4)
Reactivities (27), (15), (15), (12), (12), (2), (1), (1)
Applications (23), (10), (9), (8), (7), (4), (3), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1), (1)
back to top