Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN406124

Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Ube1c, AI256736, AI848246, AW546539, A830034N06Rik, ube1c, zgc:55528, wu:fb75e04, wu:fc37b11, UBE1C, hUBA3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN406124
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-UBA3 antibody: synthetic peptide directed towards the N terminal of human UBA3
Sequence EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLV IGAGGLGCEL
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 92%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against UBA3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name UBA3
Background UBA3 is a catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. UBA3 down-regulates steroid receptor activity. UBA3 is necessary for cell cycle progression.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight 52kDa
Gene ID 9039
NCBI Accession NP_003959, NM_003968
UniProt Q8TBC4
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-UBA3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Li, Santockyte, Shen et al.: "A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers." in: Archives of biochemistry and biophysics, Vol. 453, Issue 1, pp. 70-4, 2006 (PubMed).

Alternatives for antigen "Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3)", type "Antibodies"
Hosts (10)
Reactivities (10), (4)
Applications (9), (4), (3), (2)
Epitopes (4), (2), (1)
Beacon