Did you know that you can buy products from over 140 different suppliers from us?

Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3) (N-Term) antibody

Details for Product No. ABIN406124
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms UBE1C, hUBA3, A830034N06Rik, AI256736, AI848246, AW546539, Ube1c, ube1c, wu:fb75e04, wu:fc37b11, zgc:55528
Epitope
N-Term
(10), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(17), (3)
Host
Rabbit
(17)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(16), (10), (9), (4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN406124
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human UBA3
Sequence EGRWNHVKKFLERSGPFTHPDFEPSTESLQFLLDTCKVLV IGAGGLGCEL
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against UBA3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name UBA3
Background UBA3 is a catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. UBA3 down-regulates steroid receptor activity. UBA3 is necessary for cell cycle progression.The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E1 ubiquitin-activating enzyme family. The encoded enzyme associates with AppBp1, an amyloid beta precursor protein binding protein, to form a heterodimer, and then the enzyme complex activates NEDD8, a ubiquitin-like protein, which regulates cell division, signaling and embryogenesis. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Weight 52 kDa
Gene ID 9039
NCBI Accession NM_003968, NP_003959
UniProt Q8TBC4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 463 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3) (N-Term) antibody WB Suggested Anti-UBA3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Pancreas
anti-Ubiquitin-Like Modifier Activating Enzyme 3 (UBA3) (N-Term) antibody (2) Sample Type: 1. Human NT-2 cells (60ug)
2. mouse brain extracts (80ug)
Primary Antibody Dilution: 2ug/ml
Secondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR Bioscience
Secondary Antibody Dilution: 1: 20,000
Image Submitted by: Yuzhi Chen
University of Arkansas for Medical Science
Background publications Li, Santockyte, Shen et al.: "A general approach for investigating enzymatic pathways and substrates for ubiquitin-like modifiers." in: Archives of biochemistry and biophysics, Vol. 453, Issue 1, pp. 70-4, 2006 (PubMed).

Validation Images
back to top