GLA antibody (C-Term)

Catalog No. ABIN4886604

Product Details anti-GLA Antibody

Target: GLA (Galactosidase, alpha (GLA))

Binding Specificity: AA 218-275, C-Term

Reactivity: Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLA antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.

Sequence: DIQYYCNHWR NFDDVYDSWE SIKNILSWTV VYQKEIVEVA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Alpha-galactosidase A(Gla) detection. Tested with WB in mouse.
Gene Name: galactosidase, alpha
Protein Name: Alpha-galactosidase A

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of mouse Gla (218-275aa DIQYYCNHWRNFDDVYDSWESIKNILSWTVVYQKEIVEVA), different from the related human sequence by fifteen amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for GLA

Target: GLA (Galactosidase, alpha (GLA))

Alternative Name: Gla (GLA Products)

Synonyms: GALA antibody, Ags antibody, zgc:101584 antibody, MGC130872 antibody, SMU.877 antibody, SCF11.21 antibody, AO090005000217 antibody, alpha-GAL antibody, galactosidase alpha antibody, galactosidase, alpha antibody, galactosidase alpha S homeolog antibody, alpha-galactosidase antibody, aga antibody, alpha-galactosidase A antibody, GLA antibody, Gla antibody, gla antibody, gla.S antibody, agaN antibody, aga antibody, agaL antibody, SCO0541 antibody, rafA antibody, melA antibody, galA antibody, ANI_1_2528074 antibody, ANI_1_1502124 antibody, AOR_1_390174 antibody, CpipJ_CPIJ002066 antibody, MCYG_00962 antibody, MCYG_00791 antibody, Tsp_02909 antibody, Tsp_02508 antibody

Background: Alpha-galactosidase is a glycoside hydrolase enzyme that encoded by the GLA gene. This gene is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Synonyms: Ags | Agalsidase alfa | Alpha D galactosidase A | Alpha gal A | GALA | Galactosidase, alpha | GLA | GLA protein | Melibiase | P06280

Gene ID: 11605

UniProt: P51569

Pathways: SARS-CoV-2 Protein Interactome