Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN501674

E2F Transcription Factor 2 (E2F2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E2F-2, 9230110J10, E130207A07, E2F2, CG1071, Dmel\\CG1071, E2F, dE2F-2, dE2F2, dE2f2, de2f2, e2f2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN501674
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-E2F2 antibody: synthetic peptide directed towards the middle region of human E2F2
Sequence DQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGEGISDLF DSYDLGDLLI
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Bovine : 91%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against E2F2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name E2F2
Background E2F2 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F3, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner, and it exhibits overall 46% amino acid identity to E2F1.
Molecular Weight 47kDa
Gene ID 1870
NCBI Accession NP_004082, NM_004091
UniProt Q14209
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-E2F2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Raj, Liu, Samadashwily et al.: "Survivin repression by p53, Rb and E2F2 in normal human melanocytes." in: Carcinogenesis, Vol. 29, Issue 1, pp. 194-201, 2008 (PubMed).

Alternatives for antigen "E2F Transcription Factor 2 (E2F2)", type "Antibodies"
Hosts (49), (10), (3)
Reactivities (58), (37), (20), (12), (12), (12), (1)
Applications (47), (14), (10), (5), (3), (3), (3), (2), (1), (1)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (5), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon