Did you know that you can buy products from over 140 different suppliers from us?

Forkhead Box A1 (FOXA1) (N-Term) antibody

Details for Product No. ABIN501688
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
FoxA4a, XFD-1, fkh1, foxa1, pintallavis, xfkh1, xkfh-1, HNF3-alpha, HNF3alpha, Hnf3a, fkh2, tFoxA1, tcf3a, xfkh2, fkh, FOXA1, Ci-fkh, foxa3, Foxa1, fkd7, forkhead-7, hnf3a, HNF3A, TCF3A, HNF-3a, Hnf-3 ... show more
FoxA4a, XFD-1, fkh1, foxa1, pintallavis, xfkh1, xkfh-1, HNF3-alpha, HNF3alpha, Hnf3a, fkh2, tFoxA1, tcf3a, xfkh2, fkh, FOXA1, Ci-fkh, foxa3, Foxa1, fkd7, forkhead-7, hnf3a, HNF3A, TCF3A, HNF-3a, Hnf-3a, Tcf-3a, Tcf3a show less
Epitope
N-Term
(25), (11), (8), (7), (6), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(87), (13), (9), (4), (3), (2), (2), (1)
Host
Rabbit
(46), (31), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(68), (47), (44), (17), (6), (5), (4), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN501688
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FOXA1
Sequence LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSM NSMNTYMTMN
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Pig : 90 %, Mouse : 80 %, Rat : 80 %, African clawed frog : 80 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against FOXA1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FOXA1
Background FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
Molecular Weight 49 kDa
Gene ID 3169
NCBI Accession NM_004496, NP_004487
UniProt P55317
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 472 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Forkhead Box A1 (FOXA1) (N-Term) antibody WB Suggested Anti-FOXA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 721_B cell lysate
anti-Forkhead Box A1 (FOXA1) (N-Term) antibody (2) Sample Type: 1. Control (20ug)
2. shRNA1-FOXA1 H9 hES cells (20ug)
3. shRNA2-FOXA1 H9 hES cells (20ug)
Primary Dilution: 1:1000
Secondary Antibody: anti-Rabbit HRP
Secondary Dilution: 1:5000
Image Submitted By: Jingli Cai
Thomas Jefferson University
Background publications Lupien, Eeckhoute, Meyer et al.: "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription." in: Cell, Vol. 132, Issue 6, pp. 958-70, 2008 (PubMed).

Validation Images
back to top