Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503541

Fyn-Related Kinase (FRK) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BSK, GTK, RAK, C85044, BSK/IYK, PTK5, BK2, NGK1, FRK
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503541
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FRK antibody: synthetic peptide directed towards the middle region of human FRK
Sequence DLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTT PVAVKTLKPG
Predicted Reactivity Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Horse : 92%, Dog : 85%, Guinea pig : 78%
Characteristics This is a rabbit polyclonal antibody against FRK. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FRK
Background FRK belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.The protein encoded by this gene belongs to the TYR family of protein kinases. This tyrosine kinase is a nuclear protein and may function during G1 and S phase of the cell cycle and suppress growth.
Molecular Weight 58kDa
Gene ID 2444
NCBI Accession NP_002022, NM_002031
UniProt P42685
Research Area Kinases/Phosphatases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FRK antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Zhang, Gong, Wang et al.: "[Deoxycholate induces apoptosis in cultured normal human esophageal mucosal epithelial cells]." in: Di 1 jun yi da xue xue bao = Academic journal of the first medical college of PLA, Vol. 25, Issue 10, pp. 1240-3, 2005 (PubMed).

Background publications Zhang, Wolf-Yadlin, Ross et al.: "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." in: Molecular & cellular proteomics : MCP, Vol. 4, Issue 9, pp. 1240-50, 2005 (PubMed).

Alternatives for antigen "Fyn-Related Kinase (FRK)", type "Antibodies"
Hosts (38), (31), (3), (1)
Reactivities (69), (24), (21), (12), (12), (11)
Applications (58), (29), (19), (19), (12), (12), (9), (2), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (3), (2), (2), (2), (2), (2), (1), (1)
Beacon