Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (N-Term) antibody

Details for Product No. ABIN503981
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AI255837, AntP91a, D11Bwg1349e, Psd3, Tstap91a, P58, RPN3, S3, TSTA2
Epitope
N-Term
(6), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(27), (14), (13), (1), (1)
Host
Rabbit
(24), (4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(28), (16), (9), (4), (2)
Pubmed 1 reference available
Catalog no. ABIN503981
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PSMD3
Sequence RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQ FRPRTGKAAS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Rabbit : 90 %, African clawed frog : 80 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against PSMD3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PSMD3
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits a
Molecular Weight 61 kDa
Gene ID 5709
NCBI Accession NM_002809, NP_002800
UniProt O43242
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 534 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (N-Term) antibody WB Suggested Anti-PSMD3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (24), (4)
Reactivities (27), (14), (13), (1), (1)
Applications (28), (16), (9), (4), (2)
Epitopes (6), (1), (1), (1)
back to top