Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503981

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI255837, AntP91a, D11Bwg1349e, Psd3, Tstap91a, P58, RPN3, S3, TSTA2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503981
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMD3 antibody: synthetic peptide directed towards the N terminal of human PSMD3
Sequence RLNHYVLYKAVQGFFTSNNATRDFLLPFLEEPMDTEADLQ FRPRTGKAAS
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%, African clawed frog : 85%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against PSMD3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PSMD3
Background The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits a
Molecular Weight 61kDa
Gene ID 5709
NCBI Accession NP_002800, NM_002809
UniProt O43242
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMD3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 3 (PSMD3)", type "Antibodies"
Hosts (20), (4)
Reactivities (23), (9), (8), (1), (1)
Applications (24), (11), (6), (4), (2)
Epitopes (4), (1), (1), (1)
Beacon