Serine/threonine Kinase 19, Pseudogene 1 (STK19-PS1) (Middle Region) antibody

Details for Product No. ABIN504059
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP2, DELXp11.3, NM23-H10, NME10, TBCCD2, XRP2
Epitope
Middle Region
(3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(14), (1), (1)
Host
Rabbit
(8), (7)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(12), (7), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN504059
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RP2
Sequence LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDS FYNFADIQMG
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Bovine : 90 %, Horse : 90 %, Rabbit : 80 %, African clawed frog : 70 %
Characteristics This is a rabbit polyclonal antibody against RP2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RP2
Background The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo
Molecular Weight 40 kDa
Gene ID 6102
NCBI Accession NM_006003, NP_008846
UniProt O75695
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 350 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Serine/threonine Kinase 19, Pseudogene 1 (STK19-PS1) (Middle Region) antibody WB Suggested Anti-RP2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Muscle
anti-Serine/threonine Kinase 19, Pseudogene 1 (STK19-PS1) (Middle Region) antibody (2) Immunohistochemistry with Brain, cerebellum tissue at an antibody concentration of 5µg/ml using anti-RP2 antibody (ARP56724_P050)
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Hosts (8), (7)
Reactivities (14), (1), (1)
Applications (12), (7), (2), (1)
Epitopes (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top