Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504059

Serine/threonine Kinase 19, Pseudogene 1 (STK19-PS1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP2, DELXp11.3, NM23-H10, NME10, TBCCD2, XRP2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN504059
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RP2 antibody: synthetic peptide directed towards the middle region of human RP2
Sequence LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDS FYNFADIQMG
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Bovine : 92%, Horse : 92%, Rabbit : 85%, African clawed frog : 78%
Characteristics This is a rabbit polyclonal antibody against RP2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RP2
Background The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding. Progressive retinal degeneration may therefo
Molecular Weight 40kDa
Gene ID 6102
NCBI Accession NP_008846, NM_006003
UniProt O75695
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RP2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Serine/threonine Kinase 19, Pseudogene 1 (STK19-PS1)", type "Antibodies"
Hosts (7), (4)
Reactivities (10)
Applications (11), (7), (1), (1), (1)
Epitopes (3), (1), (1)
Beacon