Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504366

Forkhead Box A1 (FOXA1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
HNF3A, TCF3A, Hnf3a, Tcf3a, Hnf-3a, Tcf-3a, fkd7, forkhead-7, HNF-3a, HNF3-alpha, HNF3alpha, fkh2, foxa1, hnf3a, tFoxA1, tcf3a, FoxA4a, XFD-1, fkh1, pintallavis, xfkh1, xkfh-1, xfkh2, fkh, FOXA1, Ci-f ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN504366
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the N terminal of human FOXA1
Sequence MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGS MNSMNTYMTM
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, African clawed frog : 91%
Characteristics This is a rabbit polyclonal antibody against FOXA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FOXA1
Background FOXA1 is a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific transcripts such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver.
Molecular Weight 49kDa
Gene ID 3169
NCBI Accession NP_004487, NM_004496
UniProt P55317
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FOXA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lupien, Eeckhoute, Meyer et al.: "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription." in: Cell, Vol. 132, Issue 6, pp. 958-70, 2008 (PubMed).

Alternatives for antigen "Forkhead Box A1 (FOXA1)", type "Antibodies"
Hosts (38), (31), (11)
Reactivities (78), (14), (9), (6), (3), (2), (2), (2), (1)
Applications (62), (48), (44), (17), (6), (3), (3), (2), (1), (1)
Epitopes (15), (8), (6), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon