Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN504492

Spectrin alpha Chain, Brain (SPTAN1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EIEE5, NEAS, SPTA2, 2610027H02Rik, Spna-2, Spna2, A2a, IPF, SPECA, im:7157190, wu:fa20e05, wu:fb33g08, wu:fk32a10, zgc:112229
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
Pubmed 1 reference available
Catalog no. ABIN504492
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SPTAN1 antibody: synthetic peptide directed towards the N terminal of human SPTAN1
Sequence MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKL EDSYRFQFFQ
Predicted Reactivity Bovine : 100%, Chicken : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against SPTAN1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SPTAN1
Background Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.
Molecular Weight 272kDa
Gene ID 6709
NCBI Accession NP_003118, NM_003127
UniProt Q13813
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SPTAN1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Olsen, Blagoev, Gnad et al.: "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." in: Cell, Vol. 127, Issue 3, pp. 635-48, 2006 (PubMed).

Alternatives for antigen "Spectrin alpha Chain, Brain (SPTAN1)", type "Antibodies"
Hosts (52), (14)
Reactivities (51), (22), (21), (14), (12), (6), (1), (1), (1), (1)
Applications (55), (30), (14), (14), (12), (12), (10), (7), (6), (3), (2), (2), (1), (1), (1)
Conjugates (7), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (4), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon