GLS2 antibody
-
- Target See all GLS2 Antibodies
- GLS2 (Glutaminase 2 (Liver, Mitochondrial) (GLS2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLS2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Purified
- Immunogen
- GLS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids FVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMDCNKAEKFDF
- Top Product
- Discover our top product GLS2 Primary Antibody
-
-
- Application Notes
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLS2 Blocking Peptide, catalog no. 33R-3113, is also available for use as a blocking control in assays to test for specificity of this GLS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLS2 (Glutaminase 2 (Liver, Mitochondrial) (GLS2))
- Alternative Name
- GLS2 (GLS2 Products)
- Synonyms
- si:ch211-216k22.10 antibody, GA antibody, GLS antibody, LGA antibody, hLGA antibody, A330074B06Rik antibody, AI195532 antibody, Lga antibody, Ga antibody, glutaminase 2 antibody, glutaminase 2a (liver, mitochondrial) antibody, glutaminase 2 (liver, mitochondrial) antibody, glsA2 antibody, LOAG_03311 antibody, gls2a antibody, GLS2 antibody, Gls2 antibody
- Background
- GLS2 is a mitochondrial phosphate-activated glutaminase that catalyzes the hydrolysis of glutamine to stoichiometric amounts of glutamate and ammonia. This protein is functionally similar to the kidney glutaminase but is a little smaller in size. Originally thought to be liver-specific, this protein has been found in other tissues as well.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport, Warburg Effect
-