SCD antibody

Catalog No. ABIN629709

Product Details anti-SCD Antibody

Target: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SCD antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: SCD antibody was raised using a synthetic peptide corresponding to a region with amino acids HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCD Blocking Peptide, catalog no. 33R-3805, is also available for use as a blocking control in assays to test for specificity of this SCD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SCD

Target: SCD (Stearoyl-CoA Desaturase (Delta-9-Desaturase) (SCD))

Alternative Name: SCD (SCD Products)

Synonyms: FADS5 antibody, MSTP008 antibody, SCD1 antibody, SCDOS antibody, AA589638 antibody, AI265570 antibody, Scd antibody, Scd-1 antibody, ab antibody, SCD antibody, fads5 antibody, scd1 antibody, scdos antibody, F27J15.17 antibody, F27J15_17 antibody, STOMATAL CYTOKINESIS-DEFECTIVE 1 antibody, cds2 antibody, desaturase antibody, stearoyl-CoA desaturase antibody, acyl-CoA desaturase antibody, Acyl-CoA desaturase antibody, stearoyl-Coenzyme A desaturase 1 antibody, stearoyl-CoA desaturase (delta-9-desaturase) antibody, stearoyl-CoA desaturase (delta-9-desaturase) S homeolog antibody, stomatal cytokinesis defective / SCD1 protein (SCD1) antibody, acyl-CoA desaturase-like antibody, SCD antibody, CIMG_08158 antibody, VIBHAR_RS23280 antibody, acod antibody, Scd1 antibody, Scd antibody, scd antibody, LOC100346561 antibody, scd.S antibody, SCD1 antibody, LOC100719661 antibody, LOC101835884 antibody, LOC109101093 antibody

Background: Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.

Molecular Weight: 39 kDa (MW of target protein)

Pathways: Brown Fat Cell Differentiation