Endoglin antibody

Catalog No. ABIN630259

Product Details anti-Endoglin Antibody

Target: Endoglin (ENG)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Endoglin antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Purified

Immunogen: Endoglin antibody was raised using a synthetic peptide corresponding to a region with amino acids ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ

Application Details

Application Notes: WB: 2 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Endoglin Blocking Peptide, catalog no. 33R-4045, is also available for use as a blocking control in assays to test for specificity of this Endoglin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Endoglin

Target: Endoglin (ENG)

Alternative Name: Endoglin (ENG Products)

Synonyms: ENG antibody, MGC137842 antibody, DKFZp469D0419 antibody, END antibody, HHT1 antibody, ORW1 antibody, AI528660 antibody, AI662476 antibody, CD105 antibody, S-endoglin antibody, endoglin antibody, ENG antibody, Eng antibody

Background: Endoglin is a homodimeric transmembrane glycoprotein highly expressed by endothelial cells. It is a component of the transforming growth factor beta receptor complex since it binds TGFB1 and TGFB3 with high affinity. Mutations in the endoglin gene produce hereditary hemorrhagic telangiectasia.

Molecular Weight: 68 kDa (MW of target protein)