SPTAN1 antibody

Catalog No. ABIN630780

Product Details anti-SPTAN1 Antibody

Target: SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPTAN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SPTAN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPTAN1 Blocking Peptide, catalog no. 33R-5860, is also available for use as a blocking control in assays to test for specificity of this SPTAN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTAN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPTAN1

Target: SPTAN1 (Spectrin alpha Chain, Brain (SPTAN1))

Alternative Name: SPTAN1 (SPTAN1 Products)

Synonyms: im:7157190 antibody, wu:fa20e05 antibody, wu:fb33g08 antibody, wu:fk32a10 antibody, zgc:112229 antibody, 2610027H02Rik antibody, Spna-2 antibody, Spna2 antibody, EIEE5 antibody, NEAS antibody, SPTA2 antibody, A2a antibody, IPF antibody, SPECA antibody, spectrin alpha, non-erythrocytic 1 antibody, spectrin, alpha, non-erythrocytic 1 antibody, SPTAN1 antibody, sptan1 antibody, Sptan1 antibody

Background: Fodrin (SPTAN1), which seems to be involved in secretion, interacts with calmodulin in a calcium-dependent manner and is thus candidate for the calcium-dependent movement of the cytoskeleton at the membrane.

Molecular Weight: 272 kDa (MW of target protein)

Pathways: Caspase Cascade in Apoptosis, Regulation of Actin Filament Polymerization