RCHY1 antibody (N-Term)

Catalog No. ABIN630818

Product Details anti-RCHY1 Antibody

Target: RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RCHY1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RCHY1 antibody was raised against the N terminal of RCHY1

Purification: Affinity purified

Immunogen: RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RCHY1 Blocking Peptide, catalog no. 33R-4551, is also available for use as a blocking control in assays to test for specificity of this RCHY1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCHY1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RCHY1

Target: RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))

Alternative Name: RCHY1 (RCHY1 Products)

Synonyms: ARNIP antibody, CHIMP antibody, PIRH2 antibody, PRO1996 antibody, RNF199 antibody, ZNF363 antibody, Pirh2 antibody, Zfp363 antibody, Znf363 antibody, wu:fb37e07 antibody, zgc:101128 antibody, RCHY1 antibody, arnip antibody, chimp antibody, pirh2 antibody, harnip antibody, rnf199 antibody, znf363 antibody, pro1996 antibody, ring finger and CHY zinc finger domain containing 1 antibody, ring finger and CHY zinc finger domain containing 1 L homeolog antibody, RCHY1 antibody, Rchy1 antibody, rchy1 antibody, rchy1.L antibody

Background: RCHY1 has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53.

Molecular Weight: 23 kDa (MW of target protein)