RCHY1 antibody (N-Term)
-
- Target See all RCHY1 Antibodies
- RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RCHY1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RCHY1 antibody was raised against the N terminal of RCHY1
- Purification
- Affinity purified
- Immunogen
- RCHY1 antibody was raised using the N terminal of RCHY1 corresponding to a region with amino acids KLYTCRLCHDNNEDHQLDRFKVKEVQCINCEKIQHAQQTCEECSTLFGEY
- Top Product
- Discover our top product RCHY1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RCHY1 Blocking Peptide, catalog no. 33R-4551, is also available for use as a blocking control in assays to test for specificity of this RCHY1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RCHY1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RCHY1 (Ring Finger and CHY Zinc Finger Domain Containing 1, E3 Ubiquitin Protein Ligase (RCHY1))
- Alternative Name
- RCHY1 (RCHY1 Products)
- Synonyms
- ARNIP antibody, CHIMP antibody, PIRH2 antibody, PRO1996 antibody, RNF199 antibody, ZNF363 antibody, Pirh2 antibody, Zfp363 antibody, Znf363 antibody, wu:fb37e07 antibody, zgc:101128 antibody, RCHY1 antibody, arnip antibody, chimp antibody, pirh2 antibody, harnip antibody, rnf199 antibody, znf363 antibody, pro1996 antibody, ring finger and CHY zinc finger domain containing 1 antibody, ring finger and CHY zinc finger domain containing 1 L homeolog antibody, RCHY1 antibody, Rchy1 antibody, rchy1 antibody, rchy1.L antibody
- Background
- RCHY1 has ubiquitin-protein ligase activity. This protein binds with p53 and promotes the ubiquitin-mediated proteosomal degradation of p53. This gene is oncogenic because loss of p53 function contributes directly to malignant tumor development. Transcription of this gene is regulated by p53.
- Molecular Weight
- 23 kDa (MW of target protein)
-