IDH2 antibody

Catalog No. ABIN631096

Product Details anti-IDH2 Antibody

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IDH2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: IDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IDH2 Blocking Peptide, catalog no. 33R-3304, is also available for use as a blocking control in assays to test for specificity of this IDH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IDH2

Target: IDH2 (Isocitrate Dehydrogenase 2 (NADP+), Mitochondrial (IDH2))

Alternative Name: IDH2 (IDH2 Products)

Synonyms: F6P23.14 antibody, F6P23_14 antibody, IDH-II antibody, NAD+ DEPENDENT ISOCITRATE DEHYDROGENASE SUBUNIT 2 antibody, isocitrate dehydrogenase II antibody, isocitrate dehydrogenase subunit 2 antibody, D2HGA2 antibody, ICD-M antibody, IDH antibody, IDHM antibody, IDP antibody, IDPM antibody, mNADP-IDH antibody, E430004F23 antibody, IDPm antibody, Idh-2 antibody, wu:fb33c06 antibody, wu:fk31e05 antibody, wu:fq43b01 antibody, zgc:55485 antibody, idh2 antibody, IDH2 antibody, isocitrate dehydrogenase subunit 2 antibody, isocitrate dehydrogenase (NADP(+)) 2, mitochondrial antibody, isocitrate dehydrogenase 2 (NADP+), mitochondrial antibody, isocitrate dehydrogenase 2 (NADP+), mitochondrial S homeolog antibody, isocitrate dehydrogenase [NADP], mitochondrial antibody, IDH2 antibody, Idh2 antibody, idh2.S antibody, idh2 antibody, LOC100441867 antibody

Background: Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic.

Molecular Weight: 47 kDa (MW of target protein)

Pathways: Warburg Effect