Cortactin antibody (N-Term)

Catalog No. ABIN631298

Product Details anti-Cortactin Antibody

Target: Cortactin (CTTN)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cortactin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cortactin antibody was raised against the N terminal of CTTN

Purification: Affinity purified

Immunogen: Cortactin antibody was raised using the N terminal of CTTN corresponding to a region with amino acids KHCSQVDSVRGFGGKFGVQMDRVDQSAVGFEYQGKTEKHASQKDYSSGFG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cortactin Blocking Peptide, catalog no. 33R-4411, is also available for use as a blocking control in assays to test for specificity of this Cortactin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cortactin

Target: Cortactin (CTTN)

Alternative Name: Cortactin (CTTN Products)

Synonyms: EMS1 antibody, 1110020L01Rik antibody, Ems1 antibody, Cttnb antibody, CG3637 antibody, Dmel\CG3637 antibody, cortactin antibody, cttn antibody, CTTN1 antibody, P85.25 antibody, Cttn antibody, ems1 antibody, CTTN antibody, cortactin antibody, CG3637 gene product from transcript CG3637-RD antibody, cortactin S homeolog antibody, cortactin L homeolog antibody, src substrate cortactin antibody, Src substrate cortactin antibody, CTTN antibody, Cttn antibody, Cortactin antibody, cttn.S antibody, cttn.L antibody, cttn antibody, CpipJ_CPIJ006351 antibody, Bm1_57220 antibody, LOC100533277 antibody

Background: CTTN is overexpressed in breast cancer and squamous cell carcinomas of the head and neck. CTTN is localized in the cytoplasm and in areas of the cell-substratum contacts. It has two roles: (1) regulating the interactions between components of adherens-type junctions and (2) organizing the cytoskeleton and cell adhesion structures of epithelia and carcinoma cells.

Molecular Weight: 61 kDa (MW of target protein)

Pathways: MAPK Signaling