GCLC antibody (N-Term)

Catalog No. ABIN631566

Product Details anti-GCLC Antibody

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCLC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GCLC antibody was raised against the N terminal of GCLC

Purification: Affinity purified

Immunogen: GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCLC Blocking Peptide, catalog no. 33R-9653, is also available for use as a blocking control in assays to test for specificity of this GCLC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCLC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCLC

Target: GCLC (Glutamate-Cysteine Ligase, Catalytic Subunit (GCLC))

Alternative Name: GCLC (GCLC Products)

Synonyms: GCLC antibody, gclc antibody, MGC146287 antibody, 2259 antibody, CG2259 antibody, DmGCLC antibody, DmGCS antibody, DmGCSh antibody, Dmel\\CG2259 antibody, GCL antibody, GCLc antibody, GCSh antibody, Gcs antibody, Gcsh antibody, DDBDRAFT_0186120 antibody, DDBDRAFT_0231403 antibody, DDB_0186120 antibody, DDB_0231403 antibody, GCS antibody, GLCL antibody, GLCLC antibody, D9Wsu168e antibody, GLCL-H antibody, Ggcs-hs antibody, Glclc antibody, cb1049 antibody, fe36e11 antibody, wu:fe36e11 antibody, glutamate-cysteine ligase catalytic subunit antibody, glutamate-cysteine ligase, catalytic subunit antibody, Glutamate-cysteine ligase catalytic subunit antibody, gamma glutamylcysteine synthetase antibody, glutamate-cysteine ligase, catalytic subunit L homeolog antibody, glutamate-cysteine ligase, catalytic subunit S homeolog antibody, gamma-glutamylcysteine synthetase antibody, GCLC antibody, gclc antibody, Gclc antibody, LbGCS antibody, gcsA antibody, gclc.L antibody, gclc.S antibody, GSH1 antibody

Background: Glutamate-cysteine ligase, also known as gamma-glutamylcysteine synthetase is the first rate limiting enzyme of glutathione synthesis. The enzyme consists of two subunits, a heavy catalytic subunit and a light regulatory subunit. GCLC is the catalytic subunit of 637 amino acids with a calculated molecular weight of 72.773 kDa. Deficiency of gamma-glutamylcysteine synthetase in human is associated with enzymopathic hemolytic anemia.

Molecular Weight: 73 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis