UCHL3 antibody

Catalog No. ABIN631699

Product Details anti-UCHL3 Antibody

Target: UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UCHL3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UCHL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UCHL3 Blocking Peptide, catalog no. 33R-5920, is also available for use as a blocking control in assays to test for specificity of this UCHL3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UCHL3

Target: UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))

Alternative Name: UCHL3 (Uchl3 Products)

Synonyms: UCH-L3 antibody, UCH-6 antibody, RGD1561196 antibody, im:6908825 antibody, zgc:109963 antibody, uchl4 antibody, ubiquitin C-terminal hydrolase L3 antibody, ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) antibody, ubiquitin C-terminal hydrolase L3 L homeolog antibody, UCHL3 antibody, Uchl3 antibody, uchl3 antibody, uchl3.L antibody

Background: UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognises and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Feeding Behaviour, Positive Regulation of fat Cell Differentiation