PRKAA2 antibody (Middle Region)

Catalog No. ABIN631804

Product Details anti-PRKAA2 Antibody

Target: PRKAA2 (Protein Kinase, AMP-Activated, alpha 2 Catalytic Subunit (PRKAA2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRKAA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRKAA2 antibody was raised against the middle region of PRKAA2

Purification: Affinity purified

Immunogen: PRKAA2 antibody was raised using the middle region of PRKAA2 corresponding to a region with amino acids AYHLIIDNRRIMNQASEFYLASSPPSGSFMDDSAMHIPPGLKPHPERMPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRKAA2 Blocking Peptide, catalog no. 33R-1630, is also available for use as a blocking control in assays to test for specificity of this PRKAA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRKAA2

Target: PRKAA2 (Protein Kinase, AMP-Activated, alpha 2 Catalytic Subunit (PRKAA2))

Alternative Name: PRKAA2 (PRKAA2 Products)

Synonyms: AMPK antibody, AMPK2 antibody, AMPKa2 antibody, PRKAA antibody, Ampk antibody, Ampka2 antibody, 2310008I11Rik antibody, A830082D05 antibody, AMPKalpha2 antibody, AMPKA2 antibody, ampk antibody, ampk2 antibody, prkaa antibody, prkaa1 antibody, PRKAA2 antibody, protein kinase AMP-activated catalytic subunit alpha 2 antibody, protein kinase, AMP-activated, alpha 2 catalytic subunit antibody, protein kinase, AMP-activated, alpha 2 catalytic subunit S homeolog antibody, PRKAA2 antibody, Prkaa2 antibody, prkaa2.S antibody, prkaa2 antibody

Background: The protein encoded by this gene is a catalytic subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: AMPK Signaling, Carbohydrate Homeostasis, Chromatin Binding, Regulation of Carbohydrate Metabolic Process, Warburg Effect