Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

RPS6KB1 antibody (N-Term)

RPS6KB1 Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN632265
  • Target See all RPS6KB1 Antibodies
    RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
    Binding Specificity
    • 28
    • 24
    • 20
    • 19
    • 18
    • 16
    • 16
    • 15
    • 15
    • 15
    • 15
    • 15
    • 14
    • 12
    • 12
    • 11
    • 9
    • 8
    • 8
    • 8
    • 7
    • 6
    • 5
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    N-Term
    Reactivity
    • 343
    • 258
    • 255
    • 55
    • 24
    • 21
    • 20
    • 17
    • 11
    • 9
    • 9
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 1
    Human, Mouse, Rat
    Host
    • 323
    • 33
    • 4
    • 2
    Rabbit
    Clonality
    • 328
    • 34
    Polyclonal
    Conjugate
    • 164
    • 23
    • 17
    • 15
    • 15
    • 15
    • 15
    • 15
    • 15
    • 15
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 6
    This RPS6KB1 antibody is un-conjugated
    Application
    • 283
    • 141
    • 104
    • 92
    • 91
    • 73
    • 63
    • 31
    • 24
    • 16
    • 16
    • 8
    • 7
    • 4
    • 2
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    RPS6 KB1 antibody was raised against the N terminal of RPS6 B1
    Purification
    Affinity purified
    Immunogen
    RPS6 KB1 antibody was raised using the N terminal of RPS6 B1 corresponding to a region with amino acids MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL
    Top Product
    Discover our top product RPS6KB1 Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    RPS6KB1 Blocking Peptide, catalog no. 33R-6382, is also available for use as a blocking control in assays to test for specificity of this RPS6KB1 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 B1 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    RPS6KB1 (Ribosomal Protein S6 Kinase, 70kDa, Polypeptide 1 (RPS6KB1))
    Alternative Name
    RPS6KB1 (RPS6KB1 Products)
    Synonyms
    PS6K antibody, S6K antibody, S6K-beta-1 antibody, S6K1 antibody, STK14A antibody, p70 S6KA antibody, p70(S6K)-alpha antibody, p70-S6K antibody, p70-alpha antibody, 10539 antibody, 7084 antibody, CG10539 antibody, DS6K antibody, Dmel\\CG10539 antibody, Dp70S6k antibody, Dp70[s6k] antibody, Dp70s6k antibody, S6k antibody, dS6K antibody, dS6k antibody, dp70[S6k] antibody, dp70s6k antibody, dps6k antibody, ds6k antibody, fs(3)07084 antibody, l(3)07084 antibody, p70 S6K antibody, p70/S6K antibody, p70S6K antibody, p70[S6 kinase] antibody, p70[S6K] antibody, p70[S6k] antibody, p70[S6kinase] antibody, p70s6K antibody, s6k antibody, s6k11 antibody, 2610318I15Rik antibody, 4732464A07Rik antibody, 70kDa antibody, AA959758 antibody, AI256796 antibody, AI314060 antibody, p70/85s6k antibody, p70s6k antibody, p70s6k-A antibody, p70-s6k antibody, ps6k antibody, rps6kb1 antibody, rps6kb1-A antibody, s6K1 antibody, stk14a antibody, fc51h01 antibody, wu:fc51h01 antibody, zgc:55713 antibody, ribosomal protein S6 kinase B1 antibody, Ribosomal protein S6 kinase antibody, ribosomal protein S6 kinase, polypeptide 1 antibody, ribosomal protein S6 kinase B1 L homeolog antibody, ribosomal protein S6 kinase B1 S homeolog antibody, ribosomal protein S6 kinase b, polypeptide 1b antibody, RPS6KB1 antibody, S6k antibody, Rps6kb1 antibody, rps6kb1.L antibody, rps6kb1.S antibody, rps6kb1b antibody
    Background
    This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains 2 non-identical kinase catalytic domains and phosphorylates several residues of the S6 ribosomal protein.
    Molecular Weight
    59 kDa (MW of target protein)
    Pathways
    PI3K-Akt Signaling, RTK Signaling, AMPK Signaling, Regulation of Cell Size, Skeletal Muscle Fiber Development, Feeding Behaviour, G-protein mediated Events, Smooth Muscle Cell Migration, Interaction of EGFR with phospholipase C-gamma, Warburg Effect
You are here:
Support