DLG4 antibody
-
- Target See all DLG4 Antibodies
- DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLG4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS
- Top Product
- Discover our top product DLG4 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLG4 Blocking Peptide, catalog no. 33R-1027, is also available for use as a blocking control in assays to test for specificity of this DLG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLG4 (Discs, Large Homolog 4 (Drosophila) (DLG4))
- Alternative Name
- DLG4 (DLG4 Products)
- Synonyms
- 11 antibody, CG1725 antibody, CG1730 antibody, CPD antibody, DLG antibody, DLG-A antibody, Discs-large antibody, Dlg antibody, Dlg-A antibody, Dlg1 antibody, DlgA antibody, Dmel\\CG1725 antibody, Drodlg antibody, PSD95 antibody, SAP97 antibody, anon-EST:Posey93 antibody, anon-WO03040301.258 antibody, anon-WO03040301.260 antibody, anon-WO03040301.268 antibody, d. lg.-1 antibody, dlg antibody, dlg-1 antibody, dlg-A antibody, dlgA antibody, dlgS97 antibody, l(1)10Bf antibody, l(1)G0276 antibody, l(1)G0342 antibody, l(1)G0456 antibody, l(1)G19 antibody, l(1)L11 antibody, l(1)bwn antibody, l(1)d.lg-1 antibody, l(1)d.lg.-1 antibody, l(1)discs large antibody, l(1)dlg antibody, l(1)dlg-1 antibody, l(1)dlg1 antibody, l(1)l.pr.-2 antibody, l(1)lpr-2 antibody, misb antibody, dlgh4 antibody, psd95 antibody, sap90 antibody, sap-90 antibody, LLGL1 antibody, Dlgh4 antibody, PSD-95 antibody, SAP90 antibody, SAP90A antibody, Sap90 antibody, SAP-90 antibody, DLG4 antibody, discs large 1 antibody, discs, large homolog 4 antibody, discs large MAGUK scaffold protein 4 antibody, discs, large homolog 4b (Drosophila) antibody, discs, large homolog 4 (Drosophila) antibody, dlg1 antibody, dlg4 antibody, DLG4 antibody, dlg4b antibody, Dlg4 antibody
- Background
- This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. It heteromultimerizes with another MAGUK protein, DLG2, and is recruited into NMDA receptor and potassium channel clusters. These two MAGUK proteins may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene.
- Molecular Weight
- 85 kDa (MW of target protein)
- Pathways
- Regulation of Muscle Cell Differentiation, Synaptic Membrane, Skeletal Muscle Fiber Development, Asymmetric Protein Localization, Regulation of long-term Neuronal Synaptic Plasticity
-