RP2 antibody
-
- Target See all RP2 Antibodies
- RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMG
- Top Product
- Discover our top product RP2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RP2 Blocking Peptide, catalog no. 33R-4895, is also available for use as a blocking control in assays to test for specificity of this RP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RP2 (Retinitis Pigmentosa 2 (X-Linked Recessive) (RP2))
- Alternative Name
- RP2 (RP2 Products)
- Synonyms
- Rp2h antibody, RGD1565124 antibody, RP2 antibody, wu:fj10e02 antibody, wu:fm72d05 antibody, zfrp2 antibody, zgc:55632 antibody, DELXp11.3 antibody, NM23-H10 antibody, NME10 antibody, TBCCD2 antibody, XRP2 antibody, AI662636 antibody, Rp2 antibody, RP2, ARL3 GTPase activating protein antibody, XRP2 protein antibody, XRP2-like protein antibody, retinitis pigmentosa 2 (X-linked recessive) antibody, RP2, ARL3 GTPase activating protein S homeolog antibody, retinitis pigmentosa 2 homolog antibody, Rp2 antibody, RP2 antibody, Bm1_36735 antibody, PITG_13367 antibody, LOAG_11813 antibody, rp2 antibody, rp2.S antibody
- Background
- The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Ribonucleoside Biosynthetic Process
-