EIF3L antibody (N-Term)

Catalog No. ABIN632992

Product Details anti-EIF3L Antibody

Target: EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF3L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF3 EIP antibody was raised against the N terminal of EIF3 IP

Purification: Affinity purified

Immunogen: EIF3 EIP antibody was raised using the N terminal of EIF3 IP corresponding to a region with amino acids SYPADDYESEAAYDPYAYPSDYDMHTGDPKQDLAYERQYEQQTYQVIPEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF3EIP Blocking Peptide, catalog no. 33R-8952, is also available for use as a blocking control in assays to test for specificity of this EIF3EIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 IP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF3L

Target: EIF3L (Eukaryotic Translation Initiation Factor 3, Subunit L (EIF3L))

Alternative Name: EIF3EIP (EIF3L Products)

Synonyms: wu:fb66c05 antibody, zgc:64147 antibody, EIF3EIP antibody, EIF3S11 antibody, EIF3S6IP antibody, HSPC021 antibody, HSPC025 antibody, MSTP005 antibody, 0610011H21Rik antibody, D15N1e antibody, Eif3eip antibody, Eif3ip antibody, Eif3s6ip antibody, HSP-66Y antibody, PAF67 antibody, eif3eip antibody, eif3s6ip antibody, eukaryotic translation initiation factor 3, subunit 6 interacting protein antibody, eukaryotic translation initiation factor 3 subunit L antibody, eukaryotic translation initiation factor 3, subunit L antibody, eukaryotic translation initiation factor 3 subunit L L homeolog antibody, eif3s6ip antibody, EIF3L antibody, Eif3l antibody, eif3l.L antibody

Background: EIF3EIP belongs to the EIF3EIP family. It interacts with EIF3E. EIF3EIP interacts with Int-6 and is associated with eukaryotic translation initiation factor 3.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization