KCNQ4 antibody (Middle Region)
-
- Target See all KCNQ4 Antibodies
- KCNQ4 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNQ4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNQ4 antibody was raised against the middle region of KCNQ4
- Purification
- Affinity purified
- Immunogen
- KCNQ4 antibody was raised using the middle region of KCNQ4 corresponding to a region with amino acids SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ
- Top Product
- Discover our top product KCNQ4 Primary Antibody
-
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (C-Term) antibody
KCNQ4 Reactivity: Human, Mouse WB, ELISA Host: Rabbit Polyclonal unconjugated
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibodyKCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) unconjugated
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 596-695) antibodyKCNQ4 Reactivity: Human WB, ELISA Host: Mouse Monoclonal 2H6 unconjugated
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (HRP)KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) HRP
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (FITC)KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) FITC
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (Alkaline Phosphatase (AP))KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) Alkaline Phosphatase (AP)
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (Biotin)KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) Biotin
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (PE)KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) PE
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (APC)KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) APC
anti-Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4) (AA 2-77) antibody (PerCP)KCNQ4 Reactivity: Human WB, IHC, IP, IF, ICC, AA Host: Mouse Monoclonal N43-6 (Formerly S43-6) PerCP
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNQ4 Blocking Peptide, catalog no. 33R-8845, is also available for use as a blocking control in assays to test for specificity of this KCNQ4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNQ4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNQ4 (Potassium Voltage-Gated Channel, KQT-Like Subfamily, Member 4 (KCNQ4))
- Alternative Name
- KCNQ4 (KCNQ4 Products)
- Synonyms
- KCNQ4 antibody, k(v)7.4 antibody, kv7.4 antibody, DFNA2 antibody, DFNA2A antibody, KV7.4 antibody, potassium voltage-gated channel subfamily Q member 4 antibody, potassium channel, voltage gated KQT-like subfamily Q, member 4 antibody, potassium voltage-gated channel, subfamily Q, member 4 antibody, KCNQ4 antibody, kcnq4 antibody, Kcnq4 antibody
- Background
- The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug.
- Molecular Weight
- 77 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-
