MLC1 antibody (Middle Region)

Catalog No. ABIN633710

Product Details anti-MLC1 Antibody

Target: MLC1

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MLC1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MLC1 antibody was raised against the middle region of MLC1

Purification: Affinity purified

Immunogen: MLC1 antibody was raised using the middle region of MLC1 corresponding to a region with amino acids SDSANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MLC1 Blocking Peptide, catalog no. 33R-8370, is also available for use as a blocking control in assays to test for specificity of this MLC1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLC1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MLC1

Target: MLC1

Abstract: MLC1 Products

Synonyms: LVM antibody, MLC antibody, VL antibody, AW048630 antibody, BB074274 antibody, Kiaa0027-hp antibody, WKL1 antibody, mKIAA0027 antibody, si:ch211-192n14.1 antibody, megalencephalic leukoencephalopathy with subcortical cysts 1 antibody, megalencephalic leukoencephalopathy with subcortical cysts 1 homolog (human) antibody, MLC1 antibody, Mlc1 antibody, mlc1 antibody

Background: MLC1 may be a transporter. It may act as a non-selective neuronal cation channel.

Molecular Weight: 41 kDa (MW of target protein)