PHGDH antibody (Middle Region)
-
- Target See all PHGDH Antibodies
- PHGDH (phosphoglycerate Dehydrogenase (PHGDH))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHGDH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PHGDH antibody was raised against the middle region of PHGDH
- Purification
- Affinity purified
- Immunogen
- PHGDH antibody was raised using the middle region of PHGDH corresponding to a region with amino acids CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF
- Top Product
- Discover our top product PHGDH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PHGDH Blocking Peptide, catalog no. 33R-1641, is also available for use as a blocking control in assays to test for specificity of this PHGDH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHGDH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHGDH (phosphoglycerate Dehydrogenase (PHGDH))
- Alternative Name
- PHGDH (PHGDH Products)
- Synonyms
- fb38f06 antibody, zgc:65956 antibody, wu:fb38f06 antibody, embryo sac development arrest 9 antibody, F10M10.7 antibody, ECK2909 antibody, JW2880 antibody, 3-PGDH antibody, 3PGDH antibody, 4930479N23 antibody, A10 antibody, PGAD antibody, PGD antibody, PGDH antibody, SERA antibody, PDG antibody, phosphoglycerate dehydrogenase antibody, D-3-phosphoglycerate dehydrogenase antibody, 3-phosphoglycerate dehydrogenase antibody, phgdh antibody, EDA9 antibody, serA antibody, Sthe_2284 antibody, Dacet_1260 antibody, Mrub_0173 antibody, MMAH_RS07650 antibody, Arnit_0487 antibody, Ndas_0174 antibody, Mesil_2386 antibody, Slip_0010 antibody, Trad_0302 antibody, Acear_0027 antibody, Mahau_0665 antibody, MZHIL_RS05165 antibody, Mesop_1331 antibody, Thein_0855 antibody, Phgdh antibody, PHGDH antibody
- Background
- 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH, EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.
- Molecular Weight
- 57 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Warburg Effect
-