PON1 antibody (C-Term)
-
- Target See all PON1 Antibodies
- PON1 (Paraoxonase 1 (PON1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PON1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PON1 antibody was raised against the C terminal of PON1
- Purification
- Affinity purified
- Immunogen
- PON1 antibody was raised using the C terminal of PON1 corresponding to a region with amino acids ASEVLRIQNILTEEPKVTQVYAENGTVLQGSTVASVYKGKLLIGTVFHKA
- Top Product
- Discover our top product PON1 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PON1 Blocking Peptide, catalog no. 33R-1504, is also available for use as a blocking control in assays to test for specificity of this PON1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PON1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PON1 (Paraoxonase 1 (PON1))
- Alternative Name
- PON1 (PON1 Products)
- Synonyms
- esa antibody, pon antibody, pon2 antibody, MGC53915 antibody, MGC89222 antibody, PON1 antibody, ESA antibody, MVCD5 antibody, PON antibody, Pon antibody, paraoxonase 2 antibody, paraoxonase 1 antibody, pon2 antibody, PON1 antibody, Pon1 antibody
- Background
- PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It is capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. It may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation.
- Molecular Weight
- 39 kDa (MW of target protein)
-