GLA antibody (N-Term)
-
- Target See all GLA Antibodies
- GLA (Galactosidase, alpha (GLA))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLA antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLA antibody was raised against the N terminal of GLA
- Purification
- Affinity purified
- Immunogen
- GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF
- Top Product
- Discover our top product GLA Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLA Blocking Peptide, catalog no. 33R-7310, is also available for use as a blocking control in assays to test for specificity of this GLA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLA (Galactosidase, alpha (GLA))
- Alternative Name
- GLA (GLA Products)
- Synonyms
- GALA antibody, Ags antibody, zgc:101584 antibody, MGC130872 antibody, SMU.877 antibody, SCF11.21 antibody, AO090005000217 antibody, alpha-GAL antibody, galactosidase alpha antibody, galactosidase, alpha antibody, galactosidase alpha S homeolog antibody, alpha-galactosidase antibody, aga antibody, alpha-galactosidase A antibody, GLA antibody, Gla antibody, gla antibody, gla.S antibody, agaN antibody, aga antibody, agaL antibody, SCO0541 antibody, rafA antibody, melA antibody, galA antibody, ANI_1_2528074 antibody, ANI_1_1502124 antibody, AOR_1_390174 antibody, CpipJ_CPIJ002066 antibody, MCYG_00962 antibody, MCYG_00791 antibody, Tsp_02909 antibody, Tsp_02508 antibody
- Background
- GLA is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.
- Molecular Weight
- 45 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-