Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

CDK1 antibody (Middle Region)

CDK1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN634187
  • Target See all CDK1 Antibodies
    CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
    Binding Specificity
    • 34
    • 29
    • 25
    • 24
    • 18
    • 16
    • 13
    • 9
    • 8
    • 8
    • 8
    • 7
    • 6
    • 6
    • 5
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reactivity
    • 310
    • 175
    • 109
    • 36
    • 34
    • 31
    • 25
    • 20
    • 15
    • 12
    • 11
    • 11
    • 11
    • 9
    • 7
    • 6
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Human
    Host
    • 261
    • 59
    Rabbit
    Clonality
    • 251
    • 69
    Polyclonal
    Conjugate
    • 155
    • 27
    • 17
    • 15
    • 11
    • 10
    • 8
    • 8
    • 8
    • 8
    • 8
    • 8
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    This CDK1 antibody is un-conjugated
    Application
    • 255
    • 122
    • 66
    • 56
    • 54
    • 53
    • 51
    • 43
    • 40
    • 20
    • 18
    • 16
    • 6
    • 6
    • 4
    • 4
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    CDC2 antibody was raised against the middle region of Cdc2
    Purification
    Affinity purified
    Immunogen
    CDC2 antibody was raised using the middle region of Cdc2 corresponding to a region with amino acids DYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHP
    Top Product
    Discover our top product CDK1 Primary Antibody
  • Application Notes
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    CDC2 Blocking Peptide, catalog no. 33R-2241, is also available for use as a blocking control in assays to test for specificity of this CDC2 antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC2 antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    CDK1 (Cyclin-Dependent Kinase 1 (CDK1))
    Alternative Name
    CDC2 (CDK1 Products)
    Synonyms
    CDC2 antibody, CDC28A antibody, P34CDC2 antibody, Cdc2 antibody, Cdc2a antibody, p34 antibody, cdc2 antibody, wu:fc30e01 antibody, zgc:92032 antibody, PSTAIR antibody, cdc-2 antibody, cdc2-a antibody, cdc28a antibody, cdc2x1.1 antibody, p34cdc2 antibody, xcdc2 antibody, 5363 antibody, CDCDm antibody, CDK1 antibody, CDK1/CDC2 antibody, CG5363 antibody, Cdk-1 antibody, Cdk1 antibody, Dcdc2 antibody, Dm cdc2 antibody, DmCdc2 antibody, DmCdk1 antibody, Dmcdc2 antibody, Dmel\\CG5363 antibody, cdc antibody, cdc2Dm antibody, cdk1 antibody, dCdk1 antibody, group 4 antibody, l(2)31Eh antibody, CDC2A antibody, CDC2AAT antibody, CDK2 antibody, CDKA1 antibody, CDKA;1 antibody, CYCLIN-DEPENDENT KINASE A;1 antibody, cell division control 2 antibody, cdc2-b antibody, cdc2a antibody, cdc2x1.2 antibody, POL3 antibody, pold antibody, cyclin dependent kinase 1 antibody, cyclin dependent kinase like 1 antibody, Cell division control protein 2 1 antibody, cyclin-dependent kinase 1 antibody, cyclin-dependent kinase 1 S homeolog antibody, Cyclin-dependent kinase 1 antibody, cell division control 2 antibody, cell division control protein2 homolog antibody, cyclin-dependent kinase 1 L homeolog antibody, polymerase (DNA directed), delta 1, catalytic subunit L homeolog antibody, cyclin-dependent protein kinase Cdk1/Cdc2 antibody, CDK1 antibody, CDKL1 antibody, POPTR_0004s14080g antibody, Cdk1 antibody, cdk1 antibody, cdk1.S antibody, CDC2 antibody, cdc2 antibody, cdk-1 antibody, cdk1.L antibody, pold1.L antibody
    Background
    The protein encoded by CDC2 is a member of the Ser/Thr protein kinase family. This protein is a catalytic subunit of the highly conserved protein kinase complex known as M-phase promoting factor (MPF), which is essential for G1/S and G2/M phase transitions of eukaryotic cell cycle. Mitotic cyclins stably associate with this protein and function as regulatory subunits. The kinase activity of this protein is controlled by cyclin accumulation and destruction through the cell cycle. The phosphorylation and dephosphorylation of this protein also play important regulatory roles in cell cycle control.
    Molecular Weight
    27 kDa (MW of target protein)
    Pathways
    Cell Division Cycle, Fc-epsilon Receptor Signaling Pathway, Neurotrophin Signaling Pathway, Activation of Innate immune Response, Mitotic G1-G1/S Phases, DNA Replication, M Phase, Toll-Like Receptors Cascades, Synthesis of DNA
You are here:
Support