ARAF antibody (Middle Region)

Catalog No. ABIN634291

This Rabbit Polyclonal antibody specifically detects ARAF in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ARAF antibody (Middle Region) (ABIN634291)

Target: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARAF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARAF Antibody

Binding Specificity: Middle Region

Specificity: ARAF antibody was raised against the middle region of ARAF

Purification: Affinity purified

Immunogen: ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARAF Blocking Peptide, (ABIN5612132), is also available for use as a blocking control in assays to test for specificity of this ARAF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARAF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARAF

Target: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Alternative Name: ARAF

Background: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Molecular Weight: 67 kDa (MW of target protein)

Pathways: MAPK Signaling, RTK Signaling, Hepatitis C