FYN antibody (N-Term)

Catalog No. ABIN634345

Product Details anti-FYN Antibody

Target: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FYN antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FYN antibody was raised against the N terminal of FYN

Purification: Affinity purified

Immunogen: FYN antibody was raised using the N terminal of FYN corresponding to a region with amino acids GCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FYN Blocking Peptide, catalog no. 33R-3193, is also available for use as a blocking control in assays to test for specificity of this FYN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FYN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FYN

Target: FYN (FYN Oncogene Related To SRC, FGR, YES (FYN))

Alternative Name: FYN (FYN Products)

Synonyms: im:6908851 antibody, si:dkey-119m7.5 antibody, zgc:109996 antibody, c-fyn antibody, cfyn-a antibody, SLK antibody, SYN antibody, p59-FYN antibody, PKC antibody, fyn antibody, zgc:86720 antibody, AI448320 antibody, AW552119 antibody, FYN proto-oncogene, Src family tyrosine kinase antibody, FYN proto-oncogene, Src family tyrosine kinase S homeolog antibody, FYN proto-oncogene, Src family tyrosine kinase b antibody, FYN proto-oncogene, Src family tyrosine kinase L homeolog antibody, FYN proto-oncogene, Src family tyrosine kinase a antibody, Fyn proto-oncogene antibody, FYN antibody, fyn.S antibody, fynb antibody, fyn.L antibody, Fyn antibody, fyna antibody

Background: FYN is a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein.

Molecular Weight: 54 kDa (MW of target protein)

Pathways: JAK-STAT Signaling, TCR Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Feeding Behaviour, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, Activated T Cell Proliferation, Thromboxane A2 Receptor Signaling