RHEB antibody (Middle Region)

Catalog No. ABIN634367

Product Details anti-RHEB Antibody

Target: RHEB (Ras Homolog Enriched in Brain (RHEB))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RHEB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RHEB antibody was raised against the middle region of RHEB

Purification: Affinity purified

Immunogen: RHEB antibody was raised using the middle region of RHEB corresponding to a region with amino acids VGKVQIPIMLVGNKKDLHMERVISYEEGKALAESWNAAFLESSAKENQTA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RHEB Blocking Peptide, catalog no. 33R-9564, is also available for use as a blocking control in assays to test for specificity of this RHEB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHEB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RHEB

Target: RHEB (Ras Homolog Enriched in Brain (RHEB))

Alternative Name: RHEB (RHEB Products)

Synonyms: RHEB2 antibody, RHEB antibody, rheb2 antibody, CG1081 antibody, DReb antibody, Dm Rheb antibody, DmRheb antibody, Dmel\CG1081 antibody, Q9VND8 antibody, RheB antibody, dRheb antibody, rheb antibody, Ras homolog, mTORC1 binding antibody, Ras homolog enriched in brain antibody, ras homolog enriched in brain antibody, Ras homolog, mTORC1 binding L homeolog antibody, RHEB antibody, Rheb antibody, rheb antibody, rheb.L antibody

Background: This gene is a member of the small GTPase superfamily and encodes a lipid-anchored, cell membrane protein with five repeats of the RAS-related GTP-binding region.

Molecular Weight: 20 kDa (MW of target protein)

Pathways: RTK Signaling