SIGLEC10 antibody (Middle Region)
-
- Target See all SIGLEC10 Antibodies
- SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SIGLEC10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SIGLEC10 antibody was raised against the middle region of SIGLEC10
- Purification
- Affinity purified
- Immunogen
- SIGLEC10 antibody was raised using the middle region of SIGLEC10 corresponding to a region with amino acids CHVDFSRKGVSAQRTVRLRVAYAPRDLVISISRDNTPALEPQPQGNVPYL
- Top Product
- Discover our top product SIGLEC10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SIGLEC10 Blocking Peptide, catalog no. 33R-1714, is also available for use as a blocking control in assays to test for specificity of this SIGLEC10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIGLEC10 (Sialic Acid Binding Ig-Like Lectin 10 (SIGLEC10))
- Alternative Name
- SIGLEC10 (SIGLEC10 Products)
- Synonyms
- PRO940 antibody, SIGLEC-10 antibody, SLG2 antibody, Siglecg antibody, SIGLEC10 antibody, slg2 antibody, pro940 antibody, siglec-10 antibody, sialic acid binding Ig like lectin 10 antibody, sialic acid binding Ig-like lectin 10 antibody, sialic acid-binding Ig-like lectin 10 antibody, SIGLEC10 antibody, Siglec10 antibody, LOC484343 antibody, LOC100066644 antibody, siglec10 antibody, LOC100513863 antibody, LOC100340374 antibody
- Background
- SIGLEC10 is a putative adhesion molecule that mediates sialic-acid dependent binding to cells. SIGLEC10 preferentially binds to alpha-2,3- or alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, SIGLEC10 may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules.
- Molecular Weight
- 76 kDa (MW of target protein)
-