Leptin antibody (N-Term)
-
- Target See all Leptin (LEP) Antibodies
- Leptin (LEP)
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Leptin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Leptin antibody was raised against the N terminal of LEP
- Purification
- Affinity purified
- Immunogen
- Leptin antibody was raised using the N terminal of LEP corresponding to a region with amino acids MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS
- Top Product
- Discover our top product LEP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Leptin Blocking Peptide, catalog no. 33R-6105, is also available for use as a blocking control in assays to test for specificity of this Leptin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Leptin (LEP)
- Alternative Name
- Leptin (LEP Products)
- Synonyms
- ob antibody, obese antibody, LEPD antibody, OB antibody, OBS antibody, leptin antibody, Lep antibody, LEP antibody, lep antibody
- Background
- LEP is a protein that is secreted by white adipocytes, and which plays a major role in the regulation of body weight. This protein, which acts through the leptin receptor, functions as part of a signaling pathway that can inhibit food intake.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- JAK-STAT Signaling, AMPK Signaling, Hormone Transport, Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion, Regulation of Carbohydrate Metabolic Process, Feeding Behaviour, Monocarboxylic Acid Catabolic Process
-