GDF15 antibody (N-Term)

Catalog No. ABIN634798

Product Details anti-GDF15 Antibody

Target: GDF15 (Growth Differentiation Factor 15 (GDF15))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GDF15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GDF15 antibody was raised against the N terminal of GDF15

Purification: Affinity purified

Immunogen: GDF15 antibody was raised using the N terminal of GDF15 corresponding to a region with amino acids ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GDF15 Blocking Peptide, catalog no. 33R-1525, is also available for use as a blocking control in assays to test for specificity of this GDF15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDF15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GDF15

Target: GDF15 (Growth Differentiation Factor 15 (GDF15))

Alternative Name: GDF15 (GDF15 Products)

Synonyms: GDF15 antibody, GDF-15 antibody, MIC-1 antibody, MIC1 antibody, NAG-1 antibody, PDF antibody, PLAB antibody, PTGFB antibody, SBF antibody, growth differentiation factor 15 antibody, GDF15 antibody, Gdf15 antibody

Background: Bone morphogenetic proteins are members of the transforming growth factor-beta superfamily and regulate tissue differentiation and maintenance.

Molecular Weight: 34 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome