Neuregulin 1 antibody (N-Term)

Catalog No. ABIN634811

Product Details anti-Neuregulin 1 Antibody

Target: Neuregulin 1 (NRG1)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Neuregulin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NRG1 antibody was raised against the N terminal of NRG1

Purification: Affinity purified

Immunogen: NRG1 antibody was raised using the N terminal of NRG1 corresponding to a region with amino acids YMCKVISKLGNDSASANITIVESNEIITGMPASTEGAYVSSESPIRISVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NRG1 Blocking Peptide, catalog no. 33R-10187, is also available for use as a blocking control in assays to test for specificity of this NRG1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NRG1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Neuregulin 1

Target: Neuregulin 1 (NRG1)

Alternative Name: NRG1 (NRG1 Products)

Synonyms: 6030402G23Rik antibody, ARIA antibody, D230005F13Rik antibody, GGF antibody, GGFII antibody, HRG antibody, HRGalpha antibody, Hgl antibody, NDF antibody, SMDF antibody, GGF2 antibody, HGL antibody, HRG1 antibody, HRGA antibody, MST131 antibody, NRG-1 antibody, heregulin antibody, nrg1-A antibody, pro-neuregulin-1 antibody, NRG1 antibody, wu:fm70e01 antibody, DKFZp459A1838 antibody, neuregulin 1 antibody, histidine rich glycoprotein antibody, neuregulin 1 L homeolog antibody, Nrg1 antibody, NRG1 antibody, HRG antibody, nrg1.L antibody, nrg1 antibody

Background: Neuregulin 1 (NRG1) was originally identified as a 44 kDa glycoprotein that interacts with the NEU/ERBB2 receptor tyrosine kinase to increase its phosphorylation on tyrosine residues. It is known that an extraordinary variety of different isoforms are produced from the NRG1 gene by alternative splicing.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Muscle Cell Differentiation